PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF142600060CFD_t1
Common NameTRAES_3BF142600060CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 444aa    MW: 47585.9 Da    PI: 9.0907
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF142600060CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.6e-1660105147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  TRAES3BF142600060CFD_t1  60 RGHWRPAEDIKLRELVALYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 105
                              899*****************************.***********996 PP

2Myb_DNA-binding50.45.1e-16113155246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               +++ +E+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  TRAES3BF142600060CFD_t1 113 RPFSDDEEERLMAAHRFYGNK-WSMIARLFP-GRTDNAVKNHWHV 155
                              689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.30855106IPR017930Myb domain
SMARTSM007171.3E-1359108IPR001005SANT/Myb domain
SuperFamilySSF466893.44E-2760153IPR009057Homeodomain-like
PfamPF002491.6E-1560105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-2561113IPR009057Homeodomain-like
CDDcd001679.73E-1363104No hitNo description
PROSITE profilePS5129424.367107161IPR017930Myb domain
SMARTSM007172.3E-12111159IPR001005SANT/Myb domain
PfamPF002493.7E-12112154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-19114160IPR009057Homeodomain-like
CDDcd001674.10E-10114154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MMAANDDQAS SSSSSKGGGA VLTTGTATID TGYRGGGGEG GNAADPQESS SSGQSRLAAR  60
GHWRPAEDIK LRELVALYGP QNWNLIAEKL DGRSGKSCRL RWFNQLDPRI SKRPFSDDEE  120
ERLMAAHRFY GNKWSMIARL FPGRTDNAVK NHWHVIMARK YREQSIAYRR RKLNQAVQRT  180
LDSSSGLASG AGHVDVVGHH HNHLLVAAND SAIFAEPYGF SFRHCCLSFP AGAAAASALE  240
PTFCLFPGPG AGSNSVHDGR LSWPDAMAVR GGAGGGGLYW EPLPAQGDLI GGGHHEMARF  300
GSDDANGSSA AVFAVTDQAG ELFAALRLPH ALAGVTLLSL GNGALVGALF VTTVVAGVVA  360
LAAVVEMRGF VRDLCFLFFA CSTWRRSHSR RTKRCTTVGF LCTGPAWVPA RGMRLDRVHG  420
VGLIIIYLTF FGVRVLDSLG LWFE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32601607107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A077RZE80.0A0A077RZE8_WHEAT; Uncharacterized protein
STRINGMLOC_3926.11e-175(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.18e-69myb domain protein 105
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]